Recombinant Human F11R protein, GST-tagged

• Cat.No.: F11R-301280H
• Product Overview: Recombinant Human F11R (28-162 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Ser28-Ser162
• AA Sequence: SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: F11R F11 receptor [ Homo sapiens ]
• Official Symbol: F11R
• Synonyms: F11R; F11 receptor; JAM1, junctional adhesion molecule 1; junctional adhesion molecule A; CD321; JAM 1; JAM A; JAMA; JCAM; PAM 1; platelet F11 receptor; platelet adhesion molecule 1; junctional adhesion molecule 1; JAM; KAT; JAM1; PAM-1
• Gene ID: 50848
• mRNA Refseq: NM_016946
• Protein Refseq: NP_058642
• MIM: 605721
• UniProt ID: Q9Y624