Recombinant Human EXT1 protein, His-tagged

• Cat.No.: EXT1-2682H
• Product Overview: Recombinant Human EXT1 protein(435-573 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 435-573 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: FKHISRNSLIWNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIEGESKVMSSRFLPYDNIITDAVLSLDEDTVLSTT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EXT1 exostosin 1 [ Homo sapiens ]
• Official Symbol: EXT1
• Synonyms: EXT1; exostosin 1; exostoses (multiple) 1 , Langer Giedion syndrome chromosome region , LGCR, LGS; exostosin-1; Glucuronosyl N acetylglucosaminyl proteoglycan 4 alpha N acetylglucosaminyltransferase; N acetylglucosaminyl proteoglycan 4 beta glucuronosyltransferase; ttv; exostoses (multiple) 1; multiple exostoses protein 1; putative tumor suppressor protein EXT1; Langer-Giedion syndrome chromosome region; N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase; Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferase; glucuronosyl-N-acetylglucosaminyl-proteoglycan/N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; EXT; LGS; TTV; LGCR; TRPS2
• Gene ID: 2131
• mRNA Refseq: NM_000127
• Protein Refseq: NP_000118
• MIM: 608177
• UniProt ID: Q16394