Recombinant Human EXOSC3 Protein, GST-tagged
Cat.No. : | EXOSC3-3571H |
Product Overview : | Human EXOSC3 full-length ORF ( AAH02437, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012] |
Molecular Mass : | 55.99 kDa |
AA Sequence : | MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EXOSC3 exosome component 3 [ Homo sapiens ] |
Official Symbol | EXOSC3 |
Synonyms | EXOSC3; exosome component 3; exosome complex component RRP40; CGI 102; CGI 102 protein; exosome component Rrp40; hRrp 40; hRrp40p; p10; RRP40; Rrp40p; exosome complex exonuclease RRP40; ribosomal RNA-processing protein 40; CGI-102; hRrp-40; bA3J10.7; MGC723; RP11-3J10.8; MGC15120; |
Gene ID | 51010 |
mRNA Refseq | NM_001002269 |
Protein Refseq | NP_001002269 |
MIM | 606489 |
UniProt ID | Q9NQT5 |
◆ Recombinant Proteins | ||
Exosc3-2891M | Recombinant Mouse Exosc3 Protein, Myc/DDK-tagged | +Inquiry |
EXOSC3-3189Z | Recombinant Zebrafish EXOSC3 | +Inquiry |
EXOSC3-12596H | Recombinant Human EXOSC3, GST-tagged | +Inquiry |
EXOSC3-3571H | Recombinant Human EXOSC3 Protein, GST-tagged | +Inquiry |
EXOSC3-1521R | Recombinant Rhesus monkey EXOSC3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOSC3-6502HCL | Recombinant Human EXOSC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EXOSC3 Products
Required fields are marked with *
My Review for All EXOSC3 Products
Required fields are marked with *
0
Inquiry Basket