Recombinant Human EXOC7, GST-tagged

• Cat.No.: EXOC7-283H
• Product Overview: Recombinant Human EXOC7(586 a.a. - 684 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.
• Molecular Mass: 36.63 kDa
• AA Sequence: VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKN PEKYIKYGVEQVGDMIDRLFDTSA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EXOC7 exocyst complex component 7 [ Homo sapiens (human) ]
• Official Symbol: EXOC7
• Synonyms: EXOC7; exocyst complex component 7; EXO70; Exo70p; KIAA1067; YJL085W; exocyst complex component Exo70
• Gene ID: 23265
• mRNA Refseq: NM_001013839
• Protein Refseq: NP_001013861
• MIM: 608163
• UniProt ID: Q9UPT5
• Chromosome Location: 17q25.1
• Pathway: Arf6 trafficking events; Insulin Pathway; Insulin signaling pathway
• Function: protein binding