Recombinant Human EWSR1 protein, His-tagged
Cat.No. : | EWSR1-19H |
Product Overview : | Recombinant Human ATG13 protein(O75143)(Tyr231-Asp430), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Tyr231-Asp430 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 24 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | YRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSD |
Gene Name | ATG13 ATG13 autophagy related 13 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG13 |
Synonyms | ATG13; ATG13 autophagy related 13 homolog (S. cerevisiae); KIAA0652; autophagy-related protein 13; FLJ20698; |
Gene ID | 9776 |
mRNA Refseq | NM_001142673 |
Protein Refseq | NP_001136145 |
UniProt ID | O75143 |
◆ Recombinant Proteins | ||
EWSR1-1338R | Recombinant Rhesus Macaque EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EWSR1-3553H | Recombinant Human EWSR1 Protein, GST-tagged | +Inquiry |
EWSR1-28336TH | Recombinant Human EWSR1 | +Inquiry |
EWSR1-5364M | Recombinant Mouse EWSR1 Protein | +Inquiry |
EWSR1-245C | Recombinant Cynomolgus Monkey EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EWSR1-6514HCL | Recombinant Human EWSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EWSR1 Products
Required fields are marked with *
My Review for All EWSR1 Products
Required fields are marked with *
0
Inquiry Basket