Recombinant Human EWSR1

Cat.No. : EWSR1-28336TH
Product Overview : Recombinant fragment of Human EWSR1 with N terminal proprietary tag, predicted mwt: 36.19kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 96 amino acids
Description : This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
Molecular Weight : 36.190kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
Sequence Similarities : Belongs to the RRM TET family.Contains 1 IQ domain.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain.
Gene Name EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ]
Official Symbol EWSR1
Synonyms EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS;
Gene ID 2130
mRNA Refseq NM_001163285
Protein Refseq NP_001156757
MIM 133450
Uniprot ID Q01844
Chromosome Location 22q12.2
Pathway BARD1 signaling events, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function RNA binding; calmodulin binding; metal ion binding; nucleic acid binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EWSR1 Products

Required fields are marked with *

My Review for All EWSR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon