Recombinant Human EWSR1

• Cat.No.: EWSR1-28336TH
• Product Overview: Recombinant fragment of Human EWSR1 with N terminal proprietary tag, predicted mwt: 36.19kDa.

Specification

• Description: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
• Protein length: 96 amino acids
• Molecular Weight: 36.190kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
• Sequence Similarities: Belongs to the RRM TET family.Contains 1 IQ domain.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain.
• Tag: Non

Gene Information

• Gene Name: EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ]
• Official Symbol: EWSR1
• Synonyms: EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS
• Gene ID: 2130
• mRNA Refseq: NM_001163285
• Protein Refseq: NP_001156757
• MIM: 133450
• Uniprot ID: Q01844
• Chromosome Location: 22q12.2
• Pathway: BARD1 signaling events, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem
• Function: RNA binding; calmodulin binding; metal ion binding; nucleic acid binding; nucleotide binding