Recombinant Human EWSR1
Cat.No. : | EWSR1-28336TH |
Product Overview : | Recombinant fragment of Human EWSR1 with N terminal proprietary tag, predicted mwt: 36.19kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 96 amino acids |
Description : | This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. |
Molecular Weight : | 36.190kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS |
Sequence Similarities : | Belongs to the RRM TET family.Contains 1 IQ domain.Contains 1 RanBP2-type zinc finger.Contains 1 RRM (RNA recognition motif) domain. |
Gene Name | EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ] |
Official Symbol | EWSR1 |
Synonyms | EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; |
Gene ID | 2130 |
mRNA Refseq | NM_001163285 |
Protein Refseq | NP_001156757 |
MIM | 133450 |
Uniprot ID | Q01844 |
Chromosome Location | 22q12.2 |
Pathway | BARD1 signaling events, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | RNA binding; calmodulin binding; metal ion binding; nucleic acid binding; nucleotide binding; |
◆ Recombinant Proteins | ||
EWSR1-19H | Recombinant Human EWSR1 protein, His-tagged | +Inquiry |
EWSR1-876H | Recombinant Human EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EWSR1-67HFL | Active Recombinant Full Length Human EWSR1 Protein, C-Flag-tagged | +Inquiry |
EWSR1-1513R | Recombinant Rhesus monkey EWSR1 Protein, His-tagged | +Inquiry |
EWSR1-2890M | Recombinant Mouse EWSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EWSR1-6514HCL | Recombinant Human EWSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EWSR1 Products
Required fields are marked with *
My Review for All EWSR1 Products
Required fields are marked with *
0
Inquiry Basket