Recombinant Human EWSR1 Protein, GST-tagged

• Cat.No.: EWSR1-3553H
• Product Overview: Human EWSR1 partial ORF ( NP_005234, 358 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.3 kDa
• AA Sequence: SDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EWSR1 Ewing sarcoma breakpoint region 1 [ Homo sapiens ]
• Official Symbol: EWSR1
• Synonyms: EWSR1; Ewing sarcoma breakpoint region 1; RNA-binding protein EWS; EWS; Ewings sarcoma EWS-Fli1 (type 1) oncogene; bK984G1.4
• Gene ID: 2130
• mRNA Refseq: NM_001163285
• Protein Refseq: NP_001156757
• MIM: 133450
• UniProt ID: Q01844