Recombinant Human ETNK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ETNK1-2906H
• Product Overview: ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Molecular Mass: 27.8 kDa
• AA Sequence: MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPAVLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ETNK1 ethanolamine kinase 1 [ Homo sapiens (human) ]
• Official Symbol: ETNK1
• Synonyms: ETNK1; ethanolamine kinase 1; EKI; EKI1; putative protein product of Nbla10396; EKI 1; Nbla10396
• Gene ID: 55500
• mRNA Refseq: NM_001039481
• Protein Refseq: NP_001034570
• MIM: 609858
• UniProt ID: Q9HBU6