Recombinant Human ETNK1 Protein, GST-tagged

• Cat.No.: ETNK1-3524H
• Product Overview: Human ETNK1 full-length ORF ( AAH06111, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.22 kDa
• AA Sequence: MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ETNK1 ethanolamine kinase 1 [ Homo sapiens ]
• Official Symbol: ETNK1
• Synonyms: ETNK1; ethanolamine kinase 1; EKI; EKI1; putative protein product of Nbla10396; EKI 1; Nbla10396
• Gene ID: 55500
• mRNA Refseq: NM_001039481
• Protein Refseq: NP_001034570
• MIM: 609858
• UniProt ID: Q9HBU6