Recombinant Human ESX1 Protein, GST-tagged

• Cat.No.: ESX1-3513H
• Product Overview: Human ESX1L partial ORF ( NP_703149, 124 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes exclusively to the nucleus. In contrast to human, the mouse homolog has a novel PN/PF motif in the C-terminus and is paternally imprinted in placental tissue. This gene likely plays a role in placental development and spermatogenesis. [provided by RefSeq, Jan 2010]
• Molecular Mass: 35.64 kDa
• AA Sequence: AEGPQTAEGPQPPERKRRRRTAFTQFQLQELENFFDESQYPDVVARERLAARLNLTEDRVQVWFQNRRAKWKRNQRVLMLRNTATADLAH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ESX1 ESX homeobox 1 [ Homo sapiens ]
• Official Symbol: ESX1
• Synonyms: ESX1; ESX homeobox 1; ESX1L, extraembryonic, spermatogenesis, homeobox 1 homolog (mouse); homeobox protein ESX1; ESXR1; ESX1-related protein; extraembryonic, spermatogenesis, homeobox 1 homolog; ESX1L
• Gene ID: 80712
• mRNA Refseq: NM_153448
• Protein Refseq: NP_703149
• MIM: 300154
• UniProt ID: Q8N693