Recombinant Human ESR1, StrepII-tagged

• Cat.No.: ESR1-227H
• Product Overview: Purified human recombinant Estrogen receptor or ER protein (amino acids 2-181, 180 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.4 kDa. (Accession NP_000116.2; UniProt P03372)

Specification

• Species: Human
• Source: Human Cells
• Tag: StrepII
• ProteinLength: 2-181, 180 a.a.
• Description: This product is the N-terminal region of estrogen receptor. ER is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: TMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQT GLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYR PNSDNRRQGGRERLASTNDKGSMAMESAKE
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: ESR1 estrogen receptor 1 [ Homo sapiens ]
• Official Symbol: ESR1
• Synonyms: ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123
• Gene ID: 2099
• mRNA Refseq: NM_000125
• Protein Refseq: NP_000116
• UniProt ID: P03372
• Chromosome Location: 6q24-q27
• Pathway: Androgen Receptor Signaling Pathway, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem; Estrogen signaling pathway, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; Gene Expression, organism-specific biosystem
• Function: DNA binding; beta-catenin binding; chromatin binding; core promoter sequence-specific DNA binding; enzyme binding; enzyme binding; estrogen receptor activity; estrogen receptor activity; estrogen response element binding; hormone binding; identical protein binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; metal ion binding; nitric-oxide synthase regulator activity; protein binding; protein complex binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; steroid binding; steroid hormone receptor activity; steroid hormone receptor activity; transcription factor binding; type 1 metabotropic glutamate receptor binding; zinc ion binding