Recombinant Human ESR1 protein, His-Myc-tagged

• Cat.No.: ESR1-5322H
• Product Overview: Recombinant Human ESR1 protein(P03372)(315-551aa), fused with C-terminal His and Myc tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His&Myc
• Protein Length: 315-551aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA

Gene Information

• Gene Name: ESR1 estrogen receptor 1 [ Homo sapiens ]
• Official Symbol: ESR1
• Synonyms: ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123
• Gene ID: 2099
• mRNA Refseq: NM_000125
• Protein Refseq: NP_000116
• UniProt ID: P03372