Recombinant Human ESR1 protein, His-tagged

• Cat.No.: ESR1-118H
• Product Overview: Recombinant Human ESR1 is produced by E.coli expression system and the residues Met297-Ser554 is expressed with a His tag at the N-terminal.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met297-Ser554
• Form: Lyophilized from sterile 20 mM Tris, 150 mM NaCl, pH 8.0, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300.
• Molecular Mass: 33 kDa
• AA Sequence: MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVIDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 90 %
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48 h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
• Reconstitution: Reconstitute in 20 mM Tris, 150 mM NaCl (Ph 8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: ESR1 estrogen receptor 1 [ Homo sapiens ]
• Official Symbol: ESR1
• Synonyms: ER-A1; ER; ESR; ESR1; ESRA; NR3A1; NR3-A1; Estrogen Receptor 1
• Gene ID: 2099
• mRNA Refseq: NM_000125
• Protein Refseq: NP_000116
• UniProt ID: P03372