Recombinant Mouse Esm1 Protein, His-tagged

• Cat.No.: Esm1-7412M
• Product Overview: Recombinant mouse Endocan / ESM1 with a His tag was expressed in insect cells.

Specification

• Description: Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions.
• Source: Insect cell
• Species: Mouse
• Tag: His
• Form: Lyophilized
• Molecular Mass: 19.07 kDa
• AA Sequence: WSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPRTRHHHHHH
• N-terminal Sequence Analysis: WSAKYAVD
• Purity: > 95 % by SDS-PAGE and Silver staining
• Stability: Shelf life: one year from despatch.
• Storage: Prior to reconstitution store at 2-8 centigrade.
  Following reconstitution store undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade for longer.
  Avoid repeated freezing and thawing.
• Storage Buffer: H2O
• Reconstitution: Restore in water to a concentration of 0.1 mg/mL.

Gene Information

• Gene Name: Esm1 endothelial cell-specific molecule 1 [ Mus musculus (house mouse) ]
• Official Symbol: Esm1
• Synonyms: Esm1; endothelial cell-specific molecule 1; ESM-1; AV004503; 0610042H23Rik; endothelial cell-specific molecule 1
• Gene ID: 71690
• mRNA Refseq: NM_023612
• Protein Refseq: NP_076101
• UniProt ID: Q9QYY7