Recombinant Human ESCO2, GST-tagged
Cat.No. : | ESCO2-01H |
Product Overview : | Recombinant human ESCO2 protein, fused to GST-tag, was expressed in E.coli and purified by using traditional GST-affinity column. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
ProteinLength : | 2-352a.a. |
Description : | This gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. |
Molecular Mass : | 66kDa |
AA Sequence : | MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGS PFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQP KYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLE NEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHK VDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNF |
Applications : | SDS-PAGE |
Gene Name | ESCO2 establishment of cohesion 1 homolog 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ESCO2 |
Synonyms | ESCO2; establishment of cohesion 1 homolog 2 (S. cerevisiae); RBS, Roberts syndrome; N-acetyltransferase ESCO2; EFO2; ECO1 homolog 2; RBS; 2410004I17Rik; |
Gene ID | 157570 |
mRNA Refseq | NM_001017420 |
Protein Refseq | NP_001017420 |
MIM | 609353 |
UniProt ID | Q56NI9 |
Chromosome Location | 8p21.1 |
Function | metal ion binding; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
NUP210L-10993M | Recombinant Mouse NUP210L Protein | +Inquiry |
CASTOR1-3060H | Recombinant Human CASTOR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDCD6-6576M | Recombinant Mouse PDCD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B12-46H | Recombinant Human HSD17B12, GST-tagged | +Inquiry |
MFN2-5029H | Recombinant Human MFN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
DDIM-6H | Native Human D-dimer protein | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
CA6-804H | Native Human CA6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTFR1-1144HCL | Recombinant Human MTFR1 cell lysate | +Inquiry |
SCG5-2040HCL | Recombinant Human SCG5 293 Cell Lysate | +Inquiry |
TAS2R16-1246HCL | Recombinant Human TAS2R16 293 Cell Lysate | +Inquiry |
NDUFV2-3891HCL | Recombinant Human NDUFV2 293 Cell Lysate | +Inquiry |
HNF4A-5457HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESCO2 Products
Required fields are marked with *
My Review for All ESCO2 Products
Required fields are marked with *
0
Inquiry Basket