Recombinant Human ESCO1 Protein, GST-tagged

• Cat.No.: ESCO1-3496H
• Product Overview: Human ESCO1 full-length ORF ( AAH36943.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ESCO1 belongs to a conserved family of acetyltransferases involved in sister chromatid cohesion (Hou and Zou, 2005 [PubMed 15958495]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 46.3 kDa
• AA Sequence: MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ESCO1 establishment of cohesion 1 homolog 1 (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ESCO1
• Synonyms: ESCO1; establishment of cohesion 1 homolog 1 (S. cerevisiae); N-acetyltransferase ESCO1; EFO1; ESO1; KIAA1911; EFO1p; hEFO1; CTF7 homolog 1; ECO1 homolog 1; ESO1 homolog 1; establishment factor-like protein 1; CTF; ECO1; A930014I12Rik; MGC105022
• Gene ID: 114799
• mRNA Refseq: NM_052911
• Protein Refseq: NP_443143
• MIM: 609674
• UniProt ID: Q5FWF5