Recombinant Human ESAM Protein, GST-tagged
Cat.No. : | ESAM-3494H |
Product Overview : | Human ESAM full-length ORF ( AAH16868, 1 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ESAM (Endothelial Cell Adhesion Molecule) is a Protein Coding gene. Among its related pathways are Blood-Brain Barrier and Immune Cell Transmigration: VCAM-1/CD106 Signaling Pathways and Integrin Pathway. An important paralog of this gene is IGSF11. |
Molecular Mass : | 68.64 kDa |
AA Sequence : | MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ESAM endothelial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | ESAM |
Synonyms | ESAM; endothelial cell adhesion molecule; endothelial cell-selective adhesion molecule; W117m; 2310008D05Rik; LP4791 protein; HUEL (C4orf1)-interacting protein; |
Gene ID | 90952 |
mRNA Refseq | NM_138961 |
Protein Refseq | NP_620411 |
MIM | 614281 |
UniProt ID | Q96AP7 |
◆ Recombinant Proteins | ||
ESAM-2328H | Recombinant Human ESAM protein(Met1-Ala248), hFc-tagged | +Inquiry |
Esam-2870M | Recombinant Mouse Esam Protein, Myc/DDK-tagged | +Inquiry |
ESAM-701H | Recombinant Human ESAM protein(Met1-Ala248) | +Inquiry |
ESAM-1094R | Recombinant Rat ESAM Protein, Fc-tagged | +Inquiry |
ESAM-3494H | Recombinant Human ESAM Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESAM-1579MCL | Recombinant Mouse ESAM cell lysate | +Inquiry |
ESAM-2961HCL | Recombinant Human ESAM cell lysate | +Inquiry |
ESAM-1569RCL | Recombinant Rat ESAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESAM Products
Required fields are marked with *
My Review for All ESAM Products
Required fields are marked with *
0
Inquiry Basket