Recombinant Human ERP44 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ERP44-5199H
Product Overview : ERP44 MS Standard C13 and N15-labeled recombinant protein (NP_055866) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the protein disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins. It has an inferred N-terminal signal peptide, a catalytically active thioredoxin (TRX) domain, two TRX-like domains and a C-terminal ER-retention sequence. This protein functions as a pH-regulated chaperone of the secretory pathway and likely plays a role in protein quality control at the endoplasmic reticulum - Golgi interface.
Molecular Mass : 47 kDa
AA Sequence : MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ERP44 endoplasmic reticulum protein 44 [ Homo sapiens (human) ]
Official Symbol ERP44
Synonyms ERP44; endoplasmic reticulum protein 44; thioredoxin domain containing 4 (endoplasmic reticulum), TXNDC4; endoplasmic reticulum resident protein 44; KIAA0573; PDIA10; protein disulfide isomerase family A; member 10; ER protein 44; thioredoxin domain-containing protein 4; endoplasmic reticulum resident protein 44 kDa; protein disulfide isomerase family A, member 10; thioredoxin domain containing 4 (endoplasmic reticulum); TXNDC4;
Gene ID 23071
mRNA Refseq NM_015051
Protein Refseq NP_055866
MIM 609170
UniProt ID Q9BS26

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ERP44 Products

Required fields are marked with *

My Review for All ERP44 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon