Recombinant Human ERP44, His-tagged

• Cat.No.: ERP44-30129TH
• Product Overview: Recombinant full length Human TXNDC4 with an N terminal His tag; 415 amino acids, MWt 48 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 377 amino acids
• Description: ERP44 is a novel endoplasmic reticulum chaperone involved in thiol-dependent retention of the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif.
• Conjugation: HIS
• Molecular Weight: 48.000kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
• Sequence Similarities: Contains 1 thioredoxin domain.

Gene Information

• Gene Name: ERP44 endoplasmic reticulum protein 44 [ Homo sapiens ]
• Official Symbol: ERP44
• Synonyms: ERP44; endoplasmic reticulum protein 44; thioredoxin domain containing 4 (endoplasmic reticulum) , TXNDC4; endoplasmic reticulum resident protein 44; KIAA0573; PDIA10; protein disulfide isomerase family A; member 10
• Gene ID: 23071
• mRNA Refseq: NM_015051
• Protein Refseq: NP_055866
• MIM: 609170
• Uniprot ID: Q9BS26
• Chromosome Location: 9q22.33
• Function: protein disulfide isomerase activity