Recombinant Human ERP44, His-tagged
Cat.No. : | ERP44-30129TH |
Product Overview : | Recombinant full length Human TXNDC4 with an N terminal His tag; 415 amino acids, MWt 48 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 377 amino acids |
Description : | ERP44 is a novel endoplasmic reticulum chaperone involved in thiol-dependent retention of the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. |
Conjugation : | HIS |
Molecular Weight : | 48.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL |
Sequence Similarities : | Contains 1 thioredoxin domain. |
Gene Name | ERP44 endoplasmic reticulum protein 44 [ Homo sapiens ] |
Official Symbol | ERP44 |
Synonyms | ERP44; endoplasmic reticulum protein 44; thioredoxin domain containing 4 (endoplasmic reticulum) , TXNDC4; endoplasmic reticulum resident protein 44; KIAA0573; PDIA10; protein disulfide isomerase family A; member 10; |
Gene ID | 23071 |
mRNA Refseq | NM_015051 |
Protein Refseq | NP_055866 |
MIM | 609170 |
Uniprot ID | Q9BS26 |
Chromosome Location | 9q22.33 |
Function | protein disulfide isomerase activity; |
◆ Recombinant Proteins | ||
ERP44-1442H | Recombinant Human ERP44 Protein, His&GST-tagged | +Inquiry |
ERP44-30129TH | Recombinant Human ERP44, His-tagged | +Inquiry |
ERP44-30128TH | Recombinant Human ERP44, His-tagged | +Inquiry |
ERP44-5199H | Recombinant Human ERP44 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERP44-2790H | Recombinant Human Endoplasmic Reticulum Protein 44, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERP44-6543HCL | Recombinant Human ERP44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERP44 Products
Required fields are marked with *
My Review for All ERP44 Products
Required fields are marked with *
0
Inquiry Basket