Recombinant Human EREG Protein, His-tagged
Cat.No. : | EREG-001H |
Product Overview : | Recombinant Human EREG Protein, His-tagged,was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 63-108 aa |
Tag : | C-His |
Molecular Mass : | 6 kDa |
AA Sequence : | VSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.5mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Gene Name | EREG epiregulin [ Homo sapiens (human) ] |
Official Symbol | EREG |
Synonyms | EREG; epiregulin; proepiregulin; ER; |
Gene ID | 2069 |
mRNA Refseq | NM_001432 |
Protein Refseq | NP_001423 |
MIM | 602061 |
UniProt ID | O14944 |
◆ Recombinant Proteins | ||
EREG-125E | Active Recombinant Human EREG Protein (50 aa) | +Inquiry |
EREG-562H | Active Recombinant Human EREG protein(Val63-Leu108), hFc-tagged | +Inquiry |
Ereg-1999R | Recombinant Rat Ereg protein, His & T7-tagged | +Inquiry |
Ereg-198M | Recombinant Mouse Epiregulin | +Inquiry |
EREG-235H | Recombinant Human EREG protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EREG Products
Required fields are marked with *
My Review for All EREG Products
Required fields are marked with *
0
Inquiry Basket