Recombinant Human ERAS Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ERAS-1972H
• Product Overview: ERAS MS Standard C13 and N15-labeled recombinant protein (NP_853510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.3 kDa
• AA Sequence: MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ERAS ES cell expressed Ras [ Homo sapiens (human) ]
• Official Symbol: ERAS
• Synonyms: ERAS; ES cell expressed Ras; HRAS2, HRASP, v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene; GTPase ERas; E-Ras; small GTPase protein E-Ras; embryonic stem cell-expressed Ras; v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2; v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene; HRAS2; HRASP; MGC126691; MGC126693
• Gene ID: 3266
• mRNA Refseq: NM_181532
• Protein Refseq: NP_853510
• MIM: 300437
• UniProt ID: Q7Z444