Recombinant Human ERAS Protein (3-230 aa), His-tagged

Cat.No. : ERAS-1261H
Product Overview : Recombinant Human ERAS Protein (3-230 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 3-230 aa
Description : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of bryonic st cells.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.8 kDa
AA Sequence : LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name ERAS ES cell expressed Ras [ Homo sapiens ]
Official Symbol ERAS
Synonyms ERAS; GTPase ERas; E-Ras; HRAS2; HRASP; MGC126691; MGC126693;
Gene ID 3266
mRNA Refseq NM_181532
Protein Refseq NP_853510
MIM 300437
UniProt ID Q7Z444

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ERAS Products

Required fields are marked with *

My Review for All ERAS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon