Recombinant Human ERAF Protein, GST-tagged

• Cat.No.: ERAF-3436H
• Product Overview: Human ERAF full-length ORF ( NP_057717.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 38.2 kDa
• AA Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AHSP alpha hemoglobin stabilizing protein [ Homo sapiens (human) ]
• Official Symbol: ERAF
• Synonyms: AHSP; EDRF; ERAF; alpha hemoglobin stabilizing protein; alpha-hemoglobin-stabilizing protein; erythroid associated factor; erythroid-associated factor; alpha hemoglobin stabilising protein; erythroid differentiation-related factor; erythroid differentiation associated factor
• Gene ID: 51327
• mRNA Refseq: NM_016633
• Protein Refseq: NP_057717
• MIM: 605821
• UniProt ID: Q9NZD4