Recombinant Full Length Human ERAF Protein, GST-tagged
Cat.No. : | ERAF-4353HF |
Product Overview : | Human ERAF full-length ORF ( NP_057717.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 102 amino acids |
Description : | This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 38.2 kDa |
AA Sequence : | MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AHSP alpha hemoglobin stabilizing protein [ Homo sapiens (human) ] |
Official Symbol | ERAF |
Synonyms | AHSP; EDRF; ERAF; alpha hemoglobin stabilizing protein; alpha-hemoglobin-stabilizing protein; erythroid associated factor; erythroid-associated factor; alpha hemoglobin stabilising protein; erythroid differentiation-related factor; erythroid differentiation associated factor |
Gene ID | 51327 |
mRNA Refseq | NM_016633 |
Protein Refseq | NP_057717 |
MIM | 605821 |
UniProt ID | Q9NZD4 |
◆ Recombinant Proteins | ||
ERAF-4353HF | Recombinant Full Length Human ERAF Protein, GST-tagged | +Inquiry |
AHSP-370H | Recombinant Human ERAF, None tagged | +Inquiry |
ERAF-3436H | Recombinant Human ERAF Protein, GST-tagged | +Inquiry |
ERAF-12511H | Recombinant Human ERAF, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERAF Products
Required fields are marked with *
My Review for All ERAF Products
Required fields are marked with *
0
Inquiry Basket