Recombinant Human EPHB2 protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	His
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length :	886-986 aa
AA Sequence :	NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG
Purity :	90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	EPHB2 EPH receptor B2 [ Homo sapiens ]
Official Symbol	EPHB2
Synonyms	EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492;
Gene ID	2048
mRNA Refseq	NM_004442
Protein Refseq	NP_004433
MIM	600997
UniProt ID	P29323