Recombinant Human EPCAM protein(161-250 aa), C-His-tagged

• Cat.No.: EPCAM-2666H
• Product Overview: Recombinant Human EPCAM protein(P16422)(161-250 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 161-250 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: SLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIY
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: EPCAM epithelial cell adhesion molecule [ Homo sapiens ]
• Official Symbol: EPCAM
• Synonyms: EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2
• Gene ID: 4072
• mRNA Refseq: NM_002354
• Protein Refseq: NP_002345
• MIM: 185535
• UniProt ID: P16422