Recombinant Human EPCAM protein

• Cat.No.: EPCAM-77H
• Product Overview: Recombinant human EPCAM gene (24-265 aa Fragment) fused with 29aa tag domain (which could be removed using TEV enzyme) at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVM KAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWI IIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKD VKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
• Purity: >90% by SDS-PAGE
• Applications: 1. Used as coating matrix protein for Studying ES or iPS cell differentiation in vitro.2. As native antigen for antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
• Tag: Non
• Protein length: 24-265 a.a.

Gene Information

• Gene Name: EPCAM epithelial cell adhesion molecule [ Homo sapiens ]
• Official Symbol: EPCAM
• Synonyms: EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH9
• Gene ID: 4072
• mRNA Refseq: NM_002354
• Protein Refseq: NP_002345
• MIM: 185535
• UniProt ID: P16422
• Chromosome Location: 2p21
• Function: protein binding