Recombinant Human EPB42
Cat.No. : | EPB42-26437TH |
Product Overview : | Recombinant fragment of Human EPB42 with an N terminal proprietary tag; Predicted MW 36.52kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA |
Sequence Similarities : | Belongs to the transglutaminase superfamily. Transglutaminase family. |
Gene Name | EPB42 erythrocyte membrane protein band 4.2 [ Homo sapiens ] |
Official Symbol | EPB42 |
Synonyms | EPB42; erythrocyte membrane protein band 4.2; Erythrocyte surface protein band 4.2; MGC116735; MGC116737; PA; |
Gene ID | 2038 |
mRNA Refseq | NM_000119 |
Protein Refseq | NP_000110 |
MIM | 177070 |
Uniprot ID | P16452 |
Chromosome Location | 15q15-q21 |
Function | ATP binding; protein binding; protein-glutamine gamma-glutamyltransferase activity; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
EPB42-26437TH | Recombinant Human EPB42 | +Inquiry |
EPB42-4267HF | Recombinant Full Length Human EPB42 Protein, GST-tagged | +Inquiry |
EPB42-3361H | Recombinant Human EPB42 Protein, GST-tagged | +Inquiry |
EPB42-1406H | Recombinant Human EPB42 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPB42-564HCL | Recombinant Human EPB42 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPB42 Products
Required fields are marked with *
My Review for All EPB42 Products
Required fields are marked with *
0
Inquiry Basket