Recombinant Human EPB42

• Cat.No.: EPB42-26437TH
• Product Overview: Recombinant fragment of Human EPB42 with an N terminal proprietary tag; Predicted MW 36.52kDa.

Specification

• Description: Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Protein length: 99 amino acids
• Molecular Weight: 36.520kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA
• Sequence Similarities: Belongs to the transglutaminase superfamily. Transglutaminase family.
• Tag: Non

Gene Information

• Gene Name: EPB42 erythrocyte membrane protein band 4.2 [ Homo sapiens ]
• Official Symbol: EPB42
• Synonyms: EPB42; erythrocyte membrane protein band 4.2; Erythrocyte surface protein band 4.2; MGC116735; MGC116737; PA
• Gene ID: 2038
• mRNA Refseq: NM_000119
• Protein Refseq: NP_000110
• MIM: 177070
• Uniprot ID: P16452
• Chromosome Location: 15q15-q21
• Function: ATP binding; protein binding; protein-glutamine gamma-glutamyltransferase activity; structural constituent of cytoskeleton