Recombinant Human ENY2 Protein, GST-tagged

• Cat.No.: ENY2-3343H
• Product Overview: Human ENY2 full-length ORF (NP_064574.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ENY2 (ENY2, Transcription And Export Complex 2 Subunit) is a Protein Coding gene. Among its related pathways are Chromatin organization. GO annotations related to this gene include transcription coactivator activity and ligand-dependent nuclear receptor transcription coactivator activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.51 kDa
• AA Sequence: MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ENY2 enhancer of yellow 2 homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: ENY2
• Synonyms: DC6; e(y)2; ENY2; enhancer of yellow 2 homolog (Drosophila); ENY2, Transcription And Export Complex 2 Subunit 2; Enhancer Of Yellow 2 Transcription Factor Homolog; Enhancer Of Yellow 2 Homolog (Drosophila); Transcription And MRNA Export Factor ENY2; Enhancer Of Yellow 2 Homolog; E(Y)2; Sus1
• Gene ID: 56943
• mRNA Refseq: NM_020189
• Protein Refseq: NP_064574
• UniProt ID: Q9NPA8