Recombinant Human ENY2 protein, His-tagged
Cat.No. : | ENY2-5644H |
Product Overview : | Recombinant Human ENY2 protein(Q9NPA8)(1-101aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-101aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL |
Gene Name | ENY2 enhancer of yellow 2 homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | ENY2 |
Synonyms | DC6; e(y)2 |
Gene ID | 56943 |
mRNA Refseq | NM_020189.5 |
Protein Refseq | NP_064574.1 |
UniProt ID | Q9NPA8 |
◆ Recombinant Proteins | ||
ENY2-4834C | Recombinant Chicken ENY2 | +Inquiry |
ENY2-5644H | Recombinant Human ENY2 protein, His-tagged | +Inquiry |
ENY2-2805M | Recombinant Mouse ENY2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENY2-12473H | Recombinant Human ENY2, GST-tagged | +Inquiry |
ENY2-4340HF | Recombinant Full Length Human ENY2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENY2 Products
Required fields are marked with *
My Review for All ENY2 Products
Required fields are marked with *
0
Inquiry Basket