Recombinant Human ENOPH1, His-tagged

• Cat.No.: ENOPH1-29130TH
• Product Overview: Recombinant full length Human MASA (amino acids 1-261) with an N terminal His tag; 281aa, Molecular Weight: 31kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 261 amino acids
• Conjugation: HIS
• Molecular Weight: 31.000kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
• Sequence Similarities: Belongs to the HAD-like hydrolase superfamily. MasA/mtnC family.

Gene Information

• Gene Name: ENOPH1 enolase-phosphatase 1 [ Homo sapiens ]
• Official Symbol: ENOPH1
• Synonyms: ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA
• Gene ID: 58478
• mRNA Refseq: NM_021204
• Protein Refseq: NP_067027
• Uniprot ID: Q9UHY7
• Chromosome Location: 4q21.3
• Pathway: Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem
• Function: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase activity; 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase activity; acireductone synthase activity; acireductone synthase activity; hydrolase activity