Recombinant Human ENO2 protein(191-370 aa), C-His-tagged

• Cat.No.: ENO2-2609H
• Product Overview: Recombinant Human ENO2 protein(P09104)(191-370 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 191-370 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: TLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVS

Gene Information

• Gene Name: ENO2 enolase 2 (gamma, neuronal) [ Homo sapiens ]
• Official Symbol: ENO2
• Synonyms: ENO2; enolase 2 (gamma, neuronal); gamma-enolase; neural enolase; neuron-specific enolase; neurone-specific enolase; neuron specific gamma enolase; 2-phospho-D-glycerate hydrolyase; 2-phospho-D-glycerate hydro-lyase; NSE
• Gene ID: 2026
• mRNA Refseq: NM_001975
• Protein Refseq: NP_001966
• MIM: 131360
• UniProt ID: P09104