Recombinant Human ENG, StrepII-tagged

Cat.No. : ENG-300H
Product Overview : Purified human recombinant sENG (CD105) protein (amino acids 26-585, 560 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 60.7 kDa. (Accession NP_000109.1; UniProt P17813)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 26-585, 560 a.a.
Description : ENG is a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. It may play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. This protein may also be involved in preeclampsia and several types of cancer. This product, sENG, is the extracellular domain of the protein and is soluble in aqueous solutions.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
AA Sequence : ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLS VNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQA QGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAV LILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSL HASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRG DKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFV QVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCT VALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSK
Endotoxin : <0.1 eu per μg protein by lal
Purity : >95% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.
Gene Name ENG endoglin [ Homo sapiens ]
Official Symbol ENG
Synonyms ENG; endoglin; ORW, ORW1, Osler Rendu Weber syndrome 1; CD105; END; HHT1; CD105 antigen; ORW; ORW1; FLJ41744;
Gene ID 2022
mRNA Refseq NM_000118
Protein Refseq NP_000109
MIM 131195
UniProt ID P17813
Chromosome Location 9q34.11
Pathway HIF-1-alpha transcription factor network, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem;
Function activin binding; galactose binding; glycosaminoglycan binding; glycosaminoglycan binding; protein binding; contributes_to protein binding; protein homodimerization activity; protein homodimerization activity; transforming growth factor beta binding; transforming growth factor beta receptor, cytoplasmic mediator activity; transforming growth factor beta-activated receptor activity; transmembrane signaling receptor activity; type I transforming growth factor beta receptor binding; type I transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ENG Products

Required fields are marked with *

My Review for All ENG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon