Recombinant Human ENG, StrepII-tagged
Cat.No. : | ENG-300H |
Product Overview : | Purified human recombinant sENG (CD105) protein (amino acids 26-585, 560 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 60.7 kDa. (Accession NP_000109.1; UniProt P17813) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 26-585, 560 a.a. |
Description : | ENG is a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. It may play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. This protein may also be involved in preeclampsia and several types of cancer. This product, sENG, is the extracellular domain of the protein and is soluble in aqueous solutions. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | ETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLS VNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQA QGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAV LILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSL HASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRG DKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFV QVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCT VALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSK |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >95% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month. |
Gene Name | ENG endoglin [ Homo sapiens ] |
Official Symbol | ENG |
Synonyms | ENG; endoglin; ORW, ORW1, Osler Rendu Weber syndrome 1; CD105; END; HHT1; CD105 antigen; ORW; ORW1; FLJ41744; |
Gene ID | 2022 |
mRNA Refseq | NM_000118 |
Protein Refseq | NP_000109 |
MIM | 131195 |
UniProt ID | P17813 |
Chromosome Location | 9q34.11 |
Pathway | HIF-1-alpha transcription factor network, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; |
Function | activin binding; galactose binding; glycosaminoglycan binding; glycosaminoglycan binding; protein binding; contributes_to protein binding; protein homodimerization activity; protein homodimerization activity; transforming growth factor beta binding; transforming growth factor beta receptor, cytoplasmic mediator activity; transforming growth factor beta-activated receptor activity; transmembrane signaling receptor activity; type I transforming growth factor beta receptor binding; type I transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; |
◆ Recombinant Proteins | ||
ENG-12449H | Recombinant Human ENG, GST-tagged | +Inquiry |
ENG-027H | Recombinant Human ENG Protein, C-His-tagged | +Inquiry |
ENG-813H | Recombinant Human ENG protein, His-Avi-tagged | +Inquiry |
Eng-2823M | Recombinant Mouse Eng Protein, Myc/DDK-tagged | +Inquiry |
ENG-133H | Recombinant Human Endoglin,Sf9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENG-2267MCL | Recombinant Mouse ENG cell lysate | +Inquiry |
ENG-2457HCL | Recombinant Human ENG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENG Products
Required fields are marked with *
My Review for All ENG Products
Required fields are marked with *
0
Inquiry Basket