Recombinant Mouse Eng Protein

• Cat.No.: Eng-7199M
• Product Overview: Recombinant Mouse Soluble CD105/Endoglin without tag was expressed in insect cells.

Specification

• Species: Mouse
• Source: Insect Cells
• Description: Broad expression in lung adult (RPKM 303.5), adrenal adult (RPKM 138.1) and 16 other tissues.
• Form: Lyophilized
• Molecular Mass: 70-75 kDa
• AA Sequence: ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLSHHHHHH
• Endotoxin: < 0.1 ng/μg of sCD105
• Purity: > 90 % by SDS-PAGE and visualized by Silver stain
• Stability: Shelf life: one year from despatch.
• Storage: Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
  After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
  Avoid repeated freezing and thawing.
• Storage Buffer: PBS
• Reconstitution: The lyophilized sCD105 is soluble in water and most aqueous buffers. Restore in PBS or medium to a concentration not lower than 50 μg/mL.

Gene Information

• Gene Name: Eng endoglin [ Mus musculus (house mouse) ]
• Official Symbol: Eng
• Synonyms: Eng; endoglin; En; Endo; CD105; AI528660; AI662476; S-endoglin; endoglin; cell surface MJ7/18 antigen; transmembrane glycoprotein
• Gene ID: 13805
• mRNA Refseq: NM_001146348
• Protein Refseq: NP_001139820
• UniProt ID: Q3UAM9