Recombinant Human ELOF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ELOF1-1898H
Product Overview : ELOF1 MS Standard C13 and N15-labeled recombinant protein (NP_115753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.
Molecular Mass : 9.3 kDa
AA Sequence : MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ELOF1 elongation factor 1 homolog [ Homo sapiens (human) ]
Official Symbol ELOF1
Synonyms ELOF1; elongation factor 1 homolog; ELF1; transcription elongation factor 1 homolog; ELF1 homolog, elongation factor 1; elongation factor 1 homolog (ELF1, S. cerevisiae)
Gene ID 84337
mRNA Refseq NM_032377
Protein Refseq NP_115753
UniProt ID P60002

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ELOF1 Products

Required fields are marked with *

My Review for All ELOF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon