Recombinant Human ELOF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ELOF1-1898H
• Product Overview: ELOF1 MS Standard C13 and N15-labeled recombinant protein (NP_115753) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.
• Molecular Mass: 9.3 kDa
• AA Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ELOF1 elongation factor 1 homolog [ Homo sapiens (human) ]
• Official Symbol: ELOF1
• Synonyms: ELOF1; elongation factor 1 homolog; ELF1; transcription elongation factor 1 homolog; ELF1 homolog, elongation factor 1; elongation factor 1 homolog (ELF1, S. cerevisiae)
• Gene ID: 84337
• mRNA Refseq: NM_032377
• Protein Refseq: NP_115753
• UniProt ID: P60002