Recombinant Full Length Human ELOF1 Protein, GST-tagged

• Cat.No.: ELOF1-4365HF
• Product Overview: Human ELOF1 full-length ORF ( NP_115753.1, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ELOF1 (Elongation Factor 1 Homolog) is a Protein Coding gene. GO annotations related to this gene include translation elongation factor activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 35.9 kDa
• Protein length: 83 amino acids
• AA Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELOF1 elongation factor 1 homolog [ Homo sapiens (human) ]
• Official Symbol: ELOF1
• Synonyms: ELOF1; elongation factor 1 homolog; Elongation Factor 1 Homolog; Elongation Factor 1 Homolog (ELF1, S. Cerevisiae); Elongation Factor 1 Homolog (S. Cerevisiae); Transcription Elongation Factor 1 Homolog; ELF1 Homolog, Elongation Factor 1; ELF1; transcription elongation factor 1 homolog; ELF1 homolog, elongation factor 1; elongation factor 1 homolog (ELF1, S. cerevisiae)
• Gene ID: 84337
• mRNA Refseq: NM_032377
• Protein Refseq: NP_115753
• MIM: 619818
• UniProt ID: P60002