Recombinant Human ELL3 Protein, GST-tagged

Cat.No. : ELL3-3250H
Product Overview : Human ELL3 full-length ORF ( AAH19293, 1 a.a. - 397 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ELL3 (Elongation Factor For RNA Polymerase II 3) is a Protein Coding gene. Among its related pathways are Gene Expression and RNA polymerase II transcribes snRNA genes. GO annotations related to this gene include enhancer binding. An important paralog of this gene is ELL2.
Molecular Mass : 69.41 kDa
AA Sequence : MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELL3 elongation factor RNA polymerase II-like 3 [ Homo sapiens ]
Official Symbol ELL3
Synonyms ELL3; elongation factor RNA polymerase II-like 3; RNA polymerase II elongation factor ELL3; FLJ22637;
Gene ID 80237
mRNA Refseq NM_025165
Protein Refseq NP_079441
MIM 609885
UniProt ID Q9HB65

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ELL3 Products

Required fields are marked with *

My Review for All ELL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon