Recombinant Full Length Human ELL3 Protein, GST-tagged

• Cat.No.: ELL3-4358HF
• Product Overview: Human ELL3 full-length ORF ( AAH19293, 1 a.a. - 397 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ELL3 (Elongation Factor For RNA Polymerase II 3) is a Protein Coding gene. Among its related pathways are Gene Expression and RNA polymerase II transcribes snRNA genes. GO annotations related to this gene include enhancer binding. An important paralog of this gene is ELL2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 69.41 kDa
• Protein length: 397 amino acids
• AA Sequence: MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELL3 elongation factor RNA polymerase II-like 3 [ Homo sapiens ]
• Official Symbol: ELL3
• Synonyms: ELL3; elongation factor RNA polymerase II-like 3; RNA polymerase II elongation factor ELL3; FLJ22637
• Gene ID: 80237
• mRNA Refseq: NM_025165
• Protein Refseq: NP_079441
• MIM: 609885
• UniProt ID: Q9HB65