Recombinant Human EIF5B protein, His-tagged
Cat.No. : | EIF5B-452H |
Product Overview : | Recombinant Human EIF5B protein(O60841)(629-846aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 629-846aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTML |
Gene Name | EIF5B eukaryotic translation initiation factor 5B [ Homo sapiens ] |
Official Symbol | EIF5B |
Synonyms | EIF5B; eukaryotic translation initiation factor 5B; DKFZp434I036; FLJ10524; IF2; KIAA0741; translation initiation factor IF2; eIF-5B; translation initiation factor IF-2; |
Gene ID | 9669 |
mRNA Refseq | NM_015904 |
Protein Refseq | NP_056988 |
MIM | 606086 |
UniProt ID | O60841 |
◆ Recombinant Proteins | ||
EIF5B-2071R | Recombinant Rat EIF5B Protein | +Inquiry |
EIF5B-452H | Recombinant Human EIF5B protein, His-tagged | +Inquiry |
EIF5B-385H | Recombinant Human EIF5B protein, His-tagged | +Inquiry |
EIF5B-3311C | Recombinant Chicken EIF5B | +Inquiry |
EIF5B-1259R | Recombinant Rhesus Macaque EIF5B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5B-546HCL | Recombinant Human EIF5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF5B Products
Required fields are marked with *
My Review for All EIF5B Products
Required fields are marked with *
0
Inquiry Basket