Recombinant Human EIF5A Protein, GST-tagged

Cat.No. : EIF5A-3213H
Product Overview : Human EIF5A full-length ORF ( NP_001961.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EIF5A (Eukaryotic Translation Initiation Factor 5A) is a Protein Coding gene. Diseases associated with EIF5A include Hiv-1 and Retinitis Pigmentosa 14. Among its related pathways are Gamma carboxylation, hypusine formation and arylsulfatase activation and Metabolism of proteins. GO annotations related to this gene include poly(A) RNA binding and protein N-terminus binding. An important paralog of this gene is EIF5AL1.
Molecular Mass : 43.2 kDa
AA Sequence : MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ]
Official Symbol EIF5A
Synonyms EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255; eIF-4D; eIF-5A1; eIF-5A-1; rev-binding factor; eukaryotic initiation factor 5A; EIF-5A; eIF5AI;
Gene ID 1984
mRNA Refseq NM_001143760
Protein Refseq NP_001137232
MIM 600187
UniProt ID P63241

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF5A Products

Required fields are marked with *

My Review for All EIF5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon