Recombinant Human EIF5A Protein, GST-tagged

• Cat.No.: EIF5A-3213H
• Product Overview: Human EIF5A full-length ORF ( NP_001961.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EIF5A (Eukaryotic Translation Initiation Factor 5A) is a Protein Coding gene. Diseases associated with EIF5A include Hiv-1 and Retinitis Pigmentosa 14. Among its related pathways are Gamma carboxylation, hypusine formation and arylsulfatase activation and Metabolism of proteins. GO annotations related to this gene include poly(A) RNA binding and protein N-terminus binding. An important paralog of this gene is EIF5AL1.
• Molecular Mass: 43.2 kDa
• AA Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ]
• Official Symbol: EIF5A
• Synonyms: EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255; eIF-4D; eIF-5A1; eIF-5A-1; rev-binding factor; eukaryotic initiation factor 5A; EIF-5A; eIF5AI
• Gene ID: 1984
• mRNA Refseq: NM_001143760
• Protein Refseq: NP_001137232
• MIM: 600187
• UniProt ID: P63241