Recombinant Human EIF5A, His-tagged
Cat.No. : | EIF5A-27179TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-154 of Human eIF5A with an N terminal His tag. Predicted MWt: 18 kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-154 a.a. |
Description : | Eukaryotic translation initiation factor 5A-1 is a protein that in humans is encoded by the EIF5A gene. |
Conjugation : | HIS |
Tissue specificity : | Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level). |
Form : | Lyophilised:Reconstitute with 67 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Thiourea, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKI VEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHN MDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPE GDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
Sequence Similarities : | Belongs to the eIF-5A family. |
Full Length : | Full L. |
Gene Name | EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ] |
Official Symbol | EIF5A |
Synonyms | EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255; |
Gene ID | 1984 |
mRNA Refseq | NM_001143760 |
Protein Refseq | NP_001137232 |
MIM | 600187 |
Uniprot ID | P63241 |
Chromosome Location | 17p13-p12 |
Pathway | Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Translation Factors, organism-specific biosystem; |
Function | RNA binding; U6 snRNA binding; protein N-terminus binding; protein binding; ribosome binding; |
◆ Recombinant Proteins | ||
EIF5A-1727R | Recombinant Rat EIF5A Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF5A-4299HF | Recombinant Full Length Human EIF5A Protein, GST-tagged | +Inquiry |
EIF5A-362H | Recombinant Human Eukaryotic Translation Initiation Factor 5A | +Inquiry |
EIF5A-1946HFL | Recombinant Full Length Human EIF5A Protein, C-Flag-tagged | +Inquiry |
EIF5A-273H | Recombinant Human EIF5A protein(Met1-Lys154), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5A-6641HCL | Recombinant Human EIF5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF5A Products
Required fields are marked with *
My Review for All EIF5A Products
Required fields are marked with *
0
Inquiry Basket