Recombinant Human EIF5A, His-tagged

• Cat.No.: EIF5A-27179TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-154 of Human eIF5A with an N terminal His tag. Predicted MWt: 18 kDa,

Specification

• Description: Eukaryotic translation initiation factor 5A-1 is a protein that in humans is encoded by the EIF5A gene.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).
• Form: Lyophilised:Reconstitute with 67 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Thiourea, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKI VEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHN MDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPE GDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
• Sequence Similarities: Belongs to the eIF-5A family.
• Protein length: 1-154 a.a.
• Full Length: Full L.

Gene Information

• Gene Name: EIF5A eukaryotic translation initiation factor 5A [ Homo sapiens ]
• Official Symbol: EIF5A
• Synonyms: EIF5A; eukaryotic translation initiation factor 5A; eukaryotic translation initiation factor 5A-1; EIF 5A; EIF5A1; MGC99547; MGC104255
• Gene ID: 1984
• mRNA Refseq: NM_001143760
• Protein Refseq: NP_001137232
• MIM: 600187
• Uniprot ID: P63241
• Chromosome Location: 17p13-p12
• Pathway: Hypusine synthesis from eIF5A-lysine, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Post-translational modification: gamma carboxylation and hypusine formation, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Translation Factors, organism-specific biosystem
• Function: RNA binding; U6 snRNA binding; protein N-terminus binding; protein binding; ribosome binding