Recombinant Human EIF1B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: EIF1B-3035H
• Product Overview: EIF1B MS Standard C13 and N15-labeled recombinant protein (NP_005866) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Probably involved in translation.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.8 kDa
• AA Sequence: MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EIF1B eukaryotic translation initiation factor 1B [ Homo sapiens (human) ]
• Official Symbol: EIF1B
• Synonyms: EIF1B; eukaryotic translation initiation factor 1B; eukaryotic translation initiation factor 1b; GC20; translation factor sui1 homolog; protein translation factor SUI1 homolog GC20
• Gene ID: 10289
• mRNA Refseq: NM_005875
• Protein Refseq: NP_005866
• UniProt ID: O60739