Recombinant Full Length Human EIF1B Protein, GST-tagged

• Cat.No.: EIF1B-5161HF
• Product Overview: Human GC20 full-length ORF ( NP_005866.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EIF1B (Eukaryotic Translation Initiation Factor 1B) is a Protein Coding gene. Diseases associated with EIF1B include Acquired Thrombocytopenia. Among its related pathways are RNA transport. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity. An important paralog of this gene is EIF1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.2 kDa
• Protein length: 113 amino acids
• AA Sequence: MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF1B eukaryotic translation initiation factor 1B [ Homo sapiens ]
• Official Symbol: EIF1B
• Synonyms: EIF1B; eukaryotic translation initiation factor 1B; eukaryotic translation initiation factor 1b; GC20; translation factor sui1 homolog; protein translation factor SUI1 homolog GC20
• Gene ID: 10289
• mRNA Refseq: NM_005875
• Protein Refseq: NP_005866
• UniProt ID: O60739