Recombinant Human EGR1 protein, His-B2M-tagged

• Cat.No.: EGR1-2841H
• Product Overview: Recombinant Human EGR1 protein(P18146)(444-543aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&B2M
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.1 kDa
• Protein length: 444-543aa
• AA Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: EGR1 early growth response 1 [ Homo sapiens ]
• Official Symbol: EGR1
• Synonyms: EGR1; early growth response 1; early growth response protein 1; AT225; G0S30; KROX 24; nerve growth factor induced protein A; NGFI A; TIS8; transcription factor ETR103; ZIF 268; zinc finger protein 225; ZNF225; EGR-1; transcription factor Zif268; zinc finger protein Krox-24; nerve growth factor-induced protein A; NGFI-A; KROX-24; ZIF-268
• Gene ID: 1958
• mRNA Refseq: NM_001964
• Protein Refseq: NP_001955
• MIM: 128990
• UniProt ID: P18146