Recombinant Human EGLN3 Protein, GST-tagged

• Cat.No.: EGLN3-3119H
• Product Overview: Human EGLN3 full-length ORF ( NP_071356.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3) is a Protein Coding gene. Diseases associated with EGLN3 include Hypoxia and Chronic Mountain Sickness. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Development HGF signaling pathway. GO annotations related to this gene include oxidoreductase activity and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is EGLN2.
• Molecular Mass: 53.7 kDa
• AA Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EGLN3 egl nine homolog 3 (C. elegans) [ Homo sapiens ]
• Official Symbol: EGLN3
• Synonyms: EGLN3; egl nine homolog 3 (C. elegans); EGL nine (C.elegans) homolog 3; egl nine homolog 3; HIF prolyl hydroxylase 3; HIFPH3; PHD3; HPH-1; HPH-3; HIF-PH3; HIF-prolyl hydroxylase 3; egl nine-like protein 3 isoform; hypoxia-inducible factor prolyl hydroxylase 3; prolyl hydroxylase domain-containing protein 3; FLJ21620; MGC125998; MGC125999
• Gene ID: 112399
• mRNA Refseq: NM_022073
• Protein Refseq: NP_071356
• MIM: 606426
• UniProt ID: Q9H6Z9