Recombinant Full Length Human EGLN3 Protein, C-Flag-tagged

Cat.No. : EGLN3-498HFL
Product Overview : Recombinant Full Length Human EGLN3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables peptidyl-proline 4-dioxygenase activity. Involved in several processes, including activation of cysteine-type endopeptidase activity involved in apoptotic process; peptidyl-proline hydroxylation to 4-hydroxy-L-proline; and response to hypoxia. Located in cytosol and nucleus. Implicated in renal cell carcinoma. Biomarker of clear cell renal cell carcinoma.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 27.1 kDa
AA Sequence : MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSK RHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPN GDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTV
WYFDAEERAEAKKKFRNLTRKTESALTEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Pathways in cancer, Renal cell carcinoma
Full Length : Full L.
Gene Name EGLN3 egl-9 family hypoxia inducible factor 3 [ Homo sapiens (human) ]
Official Symbol EGLN3
Synonyms PHD3; HIFPH3; HIFP4H3
Gene ID 112399
mRNA Refseq NM_022073.4
Protein Refseq NP_071356.1
MIM 606426
UniProt ID Q9H6Z9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EGLN3 Products

Required fields are marked with *

My Review for All EGLN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon