Recombinant Full Length Human EGLN3 Protein, C-Flag-tagged
Cat.No. : | EGLN3-498HFL |
Product Overview : | Recombinant Full Length Human EGLN3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables peptidyl-proline 4-dioxygenase activity. Involved in several processes, including activation of cysteine-type endopeptidase activity involved in apoptotic process; peptidyl-proline hydroxylation to 4-hydroxy-L-proline; and response to hypoxia. Located in cytosol and nucleus. Implicated in renal cell carcinoma. Biomarker of clear cell renal cell carcinoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.1 kDa |
AA Sequence : | MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSK RHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPN GDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTV WYFDAEERAEAKKKFRNLTRKTESALTEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Pathways in cancer, Renal cell carcinoma |
Full Length : | Full L. |
Gene Name | EGLN3 egl-9 family hypoxia inducible factor 3 [ Homo sapiens (human) ] |
Official Symbol | EGLN3 |
Synonyms | PHD3; HIFPH3; HIFP4H3 |
Gene ID | 112399 |
mRNA Refseq | NM_022073.4 |
Protein Refseq | NP_071356.1 |
MIM | 606426 |
UniProt ID | Q9H6Z9 |
◆ Recombinant Proteins | ||
EGLN3-12498Z | Recombinant Zebrafish EGLN3 | +Inquiry |
EGLN3-2681M | Recombinant Mouse EGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGLN3-6851H | Recombinant Human Egl Nine Homolog 3 (C. elegans), His-tagged | +Inquiry |
EGLN3-1223R | Recombinant Rhesus Macaque EGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGLN3-2544H | Recombinant Human EGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN3-6693HCL | Recombinant Human EGLN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGLN3 Products
Required fields are marked with *
My Review for All EGLN3 Products
Required fields are marked with *
0
Inquiry Basket