Recombinant Human EGLN3 protein, GST-tagged

• Cat.No.: EGLN3-1844H
• Product Overview: Recombinant Human EGLN3 protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EGLN3 egl nine homolog 3 (C. elegans) [ Homo sapiens ]
• Official Symbol: EGLN3
• Synonyms: EGLN3; egl nine homolog 3 (C. elegans); EGL nine (C.elegans) homolog 3; egl nine homolog 3; HIF prolyl hydroxylase 3; HIFPH3; PHD3; HPH-1; HPH-3; HIF-PH3; HIF-prolyl hydroxylase 3; egl nine-like protein 3 isoform; hypoxia-inducible factor prolyl hydroxylase 3; prolyl hydroxylase domain-containing protein 3; FLJ21620; MGC125998; MGC125999
• Gene ID: 112399
• mRNA Refseq: NM_022073
• Protein Refseq: NP_071356
• MIM: 606426
• UniProt ID: Q9H6Z9