Recombinant Human EGFR protein, Avi/His-tagged, Biotinylated
Cat.No. : | EGFR-287H |
Product Overview : | Recombinant Human EGFR(Leu 25 - Ser 645) fused with Avi/His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Avi&His |
Protein Length : | Leu 25 - Ser 645 |
Description : | The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. The type III EGF deletion-mutant receptor (EGFRvIII) is the most common mutation and was first identified in primary human glioblastoma tumors; EGFR gene amplification is correlated with the structural rearrangement of the gene. The EGFRvIII gene has an in-frame deletion of 801 base pairs, corresponding to exons 2–7 in the mRNA, resulting in the deletion of amino acids 30-297 in the extracellular domain and the generation of a glycine at the fusion point |
Predicted N Terminal : | Leu 25 |
Form : | Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization. |
Molecular Mass : | Has a calculated MW of 41.3 kDa. As a result of glycosylation, The protein migrates as 60-70 kDa under reducing (R) condition and 60-70 kDa under non-reducing (NR) condition on SDS-PAGE gel. |
AA Sequence : | LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSGLNDIFEAQKIEWHEHHHHHH |
Endotoxin : | Less than 1.0 EU per μg by the LAL method. |
Purity : | >95% as determined by SDS-PAGE. |
Storage : | For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower. Please avoid repeated freeze-thaw cycles. No activity loss is observed after storage at: 4-8 centigrade for 12 months in lyophilized state; -70 centigrade for 3 months under sterile conditions after reconstitution. |
Reconstitution : | Reconstitute at 200 μg/mL in sterile deionized water. |
Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
Official Symbol | EGFR |
Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
Gene ID | 1956 |
mRNA Refseq | NM_005228 |
Protein Refseq | NP_005219 |
MIM | 131550 |
UniProt ID | P00533 |
Chromosome Location | 7p12 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bladder cancer, organism-specific biosystem; |
Function | ATP binding; MAPK/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding; epidermal growth factor-activated receptor activity; epidermal growth factor-activated receptor activity; identical protein binding; contributes_to nitric-oxide synthase regulator activity; nucleotide binding; protein binding; protein heterodimerization activity; protein phosphatase binding; protein tyrosine kinase activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; signal transducer activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
EGFR-076H | Recombinant Human EGFR Protein, DYKDDDDK-tagged | +Inquiry |
EGFR-7629H | Recombinant Human EGFR protein, His & S-tagged | +Inquiry |
EGFR-315H | Recombinant Human Epidermal Growth Factor Receptor, His-tagged | +Inquiry |
EGFR-101MF | Recombinant Mouse EGFR Protein, His-tagged, FITC conjugated | +Inquiry |
EGFR-464HA | Recombinant Human EGFR protein, Fc-tagged, APC labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
0
Inquiry Basket