Recombinant Human EFNA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: EFNA2-3054H
• Product Overview: EFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
• Molecular Mass: 23.88 kDa
• AA Sequence: MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EFNA2 ephrin-A2 [ Homo sapiens (human) ]
• Official Symbol: EFNA2
• Synonyms: EFNA2; ephrin-A2; EPLG6; ELF 1; LERK6; HEK7 ligand; eph-related receptor tyrosine kinase ligand 6; ELF-1; HEK7-L; LERK-6
• Gene ID: 1943
• mRNA Refseq: NM_001405
• Protein Refseq: NP_001396
• MIM: 602756
• UniProt ID: O43921