Recombinant Human EDNRA Protein, GST-tagged
Cat.No. : | EDNRA-3058H |
Product Overview : | Human EDNRA full-length ORF ( ENSP00000315011, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 75.1 kDa |
AA Sequence : | METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EDNRA endothelin receptor type A [ Homo sapiens ] |
Official Symbol | EDNRA |
Synonyms | EDNRA; endothelin receptor type A; endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor; ETA; ET-A; ETAR; ETRA; ETA-R; hET-AR; |
Gene ID | 1909 |
mRNA Refseq | NM_001166055 |
Protein Refseq | NP_001159527 |
MIM | 131243 |
UniProt ID | P25101 |
◆ Recombinant Proteins | ||
EDNRA-1380R | Recombinant Rhesus monkey EDNRA Protein, His-tagged | +Inquiry |
EDNRA-2371H | Recombinant Human EDNRA Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL7029CF | Recombinant Full Length Dog Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
EDNRA-764H | Active Recombinant Human EDNRA Full Length Transmembrane protein(VLPs) | +Inquiry |
EDNRA-3058H | Recombinant Human EDNRA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDNRA-6718HCL | Recombinant Human EDNRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDNRA Products
Required fields are marked with *
My Review for All EDNRA Products
Required fields are marked with *
0
Inquiry Basket